BDNF anticorps (Middle Region)

N° du produit ABIN634782

Cet anticorps anti-BDNF est un anticorps Lapin Polyclonal détectant BDNF dans WB. Adapté pour Humain, Rat, Souris et Chien.

Aperçu rapide pour BDNF anticorps (Middle Region) (ABIN634782)

Antigène: BDNF (Brain-Derived Neurotrophic Factor (BDNF))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BDNF est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BDNF anticorps

Épitope: Middle Region

Specificité: BDNF antibody was raised against the middle region of BDNF

Purification: Affinity purified

Immunogène: BDNF antibody was raised using the middle region of BDNF corresponding to a region with amino acids EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BDNF Blocking Peptide, (ABIN938199), is also available for use as a blocking control in assays to test for specificity of this BDNF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BDNF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BDNF

Antigène: BDNF (Brain-Derived Neurotrophic Factor (BDNF))

Autre désignation: BDNF

Sujet: BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Signalisation RTK, Synaptic Membrane, Feeding Behaviour, Dicarboxylic Acid Transport, Regulation of long-term Neuronal Synaptic Plasticity